PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa02g001190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 1033aa    MW: 113023 Da    PI: 4.9677
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa02g001190.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS281.23.1e-861544772345
            GRAS   2 velLlecAeavss..gdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                     +e+L+++Ae+++s  gd+ laq +Larl+++ +sp g+p++R+a+yf+eAL++ l++          +++ ++++ + ++aa+k fse+sP+l+f
  Csa02g001190.1 154 TEQLVKAAEVIESggGDTCLAQGILARLNQQlSSPVGKPLERAAFYFKEALNNLLHN---------VSQTLNPYSLIFKIAAYKSFSEISPVLQF 239
                     789*********98789************998************************9.........55566667789****************** PP

            GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                     +++t Nqa+le+++g +r+Hi+Dfdi++G+QW++L+q+L  R++ +p sl+iT+++sp+++++ el  t+++L++fA+e++++++++vl  + l 
  Csa02g001190.1 240 ANFTSNQALLESFQGFHRLHIVDFDIGYGGQWASLMQELVLRDNAAPlSLKITVFASPANHDQLELGFTQDNLKHFASEINISLDIQVLSLDLLG 334
                     *******************************************99998****************************************8555555 PP

            GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                     ++  +  + +++Ea+aVn++ + ++ l          + vL++vk+lsP+++v++++ +++++ +F ++++++l+ ++al++sl+a   ++ +++
  Csa02g001190.1 335 SI-SWPNESEEKEAVAVNISPASFSQL----------PLVLRFVKHLSPTIIVCSDRGCERTDLPFPQQLAQSLHSHAALLESLDAV-NANLDAM 417
                     55.56667888*********9887776..........67*********************************************887.56779** PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                     +k+Er+l+++ei+++v+ + +     ++ +++W++++ ++GF+pv+ s+++++qa++l+++++
  Csa02g001190.1 418 QKIERFLIQPEIEKLVMDRSRP---IERPMMTWQAMFLQMGFSPVTHSNFTESQAECLVQRTP 477
                     ******************9998...55677******************************987 PP

2GRAS326.64.7e-10067610282374
            GRAS    2 velLlecAeavss..gdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91  
                      +e+L+++Ae+++s  gd+ laq +Larl+++ +sp g+p++R+a+yf+eAL++ l++          +++ ++++ + ++aa+k fse+sP+l
  Csa02g001190.1  676 TEQLVKAAEVIESggGDTCLAQGILARLNQQlSSPVGKPLERAAFYFKEALNNLLHN---------VSQTLNPYSLIFKIAAYKSFSEISPVL 759 
                      689*********98789************998************************9.........55566667789**************** PP

            GRAS   92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183 
                      +f+++t Nqa+le+++g +r+Hi+Dfdi++G+QW++L+q+L  R++ +p sl+iT+++sp+++++ el  t+++L++fA+e++++++++vl  
  Csa02g001190.1  760 QFANFTSNQALLESFQGFHRLHIVDFDIGYGGQWASLMQELVLRDNAAPlSLKITVFASPANHDQLELGFTQDNLKHFASEINISLDIQVLSL 852 
                      *********************************************99998****************************************855 PP

            GRAS  184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276 
                      + l ++  +  + +++Ea+aVn++ + ++ l          + vL++vk+lsP+++v++++ +++++ +F ++++++l+ ++al++sl+a   
  Csa02g001190.1  853 DLLGSI-SWPNESEEKEAVAVNISPASFSQL----------PLVLRFVKHLSPTIIVCSDRGCERTDLPFPQQLAQSLHSHAALLESLDAV-N 933 
                      555555.56667888*********9887776..........67*********************************************887.5 PP

            GRAS  277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369 
                      ++ ++++k+Er+l+++ei+++v+ + +     ++ +++W++++ ++GF+pv+ s+++++qa++l+++++++g++ve++++sl+l+W++ +Lv 
  Csa02g001190.1  934 ANLDAMQKIERFLIQPEIEKLVMDRSRP---IERPMMTWQAMFLQMGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRTELVG 1023
                      6779********************9998...55677********************************************************* PP

            GRAS  370 vSaWr 374 
                      vSaWr
  Csa02g001190.1 1024 VSAWR 1028
                      ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.075127486IPR005202Transcription factor GRAS
PfamPF035141.1E-83154477IPR005202Transcription factor GRAS
PROSITE profilePS5098539.9436491008IPR005202Transcription factor GRAS
PfamPF035141.6E-976761028IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 1033 aa     Download sequence    Send to blast
MYDMQTYAEP NSVLDALISP TSSSTVSSSH GGNSAVGGGG VATTDEHCGQ VVLGDWEQVP  60
HDQEQSILRL IMGDSTDPSL ELNSILQTSP TFHDSDYASP GFGVVDTTGF ALDHHSVPGL  120
LINQSQTHYT QNPAAIYYGH PPAKRLNPGP IGLTEQLVKA AEVIESGGGD TCLAQGILAR  180
LNQQLSSPVG KPLERAAFYF KEALNNLLHN VSQTLNPYSL IFKIAAYKSF SEISPVLQFA  240
NFTSNQALLE SFQGFHRLHI VDFDIGYGGQ WASLMQELVL RDNAAPLSLK ITVFASPANH  300
DQLELGFTQD NLKHFASEIN ISLDIQVLSL DLLGSISWPN ESEEKEAVAV NISPASFSQL  360
PLVLRFVKHL SPTIIVCSDR GCERTDLPFP QQLAQSLHSH AALLESLDAV NANLDAMQKI  420
ERFLIQPEIE KLVMDRSRPI ERPMMTWQAM FLQMGFSPVT HSNFTESQAE CLVQRTPSAM  480
LLPFEEFQGK GISYFSSFSS SSSSFSQPPS PLLSRRKTIV GGEEVEVPTA EPNSVLDALI  540
SPTSSSTVSS SHGGNSAVGG GGVATTDEHC GQVVLGDWEQ VPHDQEQSIL RLIMGDSTDP  600
SLELNSILQT SPTFHDSDYA SPGFGVVDTT GFALDHHSVP SLLINQSQTH YTQNPSAIYY  660
GHPPAKRLNP GPMGITEQLV KAAEVIESGG GDTCLAQGIL ARLNQQLSSP VGKPLERAAF  720
YFKEALNNLL HNVSQTLNPY SLIFKIAAYK SFSEISPVLQ FANFTSNQAL LESFQGFHRL  780
HIVDFDIGYG GQWASLMQEL VLRDNAAPLS LKITVFASPA NHDQLELGFT QDNLKHFASE  840
INISLDIQVL SLDLLGSISW PNESEEKEAV AVNISPASFS QLPLVLRFVK HLSPTIIVCS  900
DRGCERTDLP FPQQLAQSLH SHAALLESLD AVNANLDAMQ KIERFLIQPE IEKLVMDRSR  960
PIERPMMTWQ AMFLQMGFSP VTHSNFTESQ AECLVQRTPV RGFHVEKKHN SLLLCWQRTE  1020
LVGVSAWRCR SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-30165102813375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0363030.0AF036303.1 Arabidopsis thaliana scarecrow-like 6 (SCL6) mRNA, partial cds.
GenBankAF4628310.0AF462831.1 Arabidopsis thaliana AT4g00150/F6N15_20 mRNA, complete cds.
GenBankAK1172980.0AK117298.1 Arabidopsis thaliana mRNA, clone: RAFL16-86-D11.
GenBankAL1614710.0AL161471.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 1.
GenBankAY1335370.0AY133537.1 Arabidopsis thaliana At4g00150/F6N15_20 mRNA, complete cds.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankF6N150.0AF069299.1 Arabidopsis thaliana BAC F6N15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010426616.10.0PREDICTED: scarecrow-like protein 6 isoform X1
SwissprotO813160.0SCL6_ARATH; Scarecrow-like protein 6
TrEMBLR0H9P40.0R0H9P4_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__3689__AT4G00150.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85742739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.10.0GRAS family protein